| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Neuropilin-1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. ICC/IF reported in scientific literature (PMID: 24918638). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Neuropilin-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Neuropilin-1. This antibody reacts with human, mouse. The Neuropilin-1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Neuropilin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE |
| Other Names | BDCA4, CD304 antigen, DKFZp686A03134, DKFZp781F1414, neuropilin 1, neuropilin-1, NRPNP1, transmembrane receptor, Vascular endothelial cell growth factor 165 receptor, VEGF165RCD304 |
| Gene, Accession # | NRP1, Gene ID: 8829 |
| Catalog # | NBP1-85763 |
| Price | |
| Order / More Info | Neuropilin-1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24918638 |
| 產(chǎn)品資料 |
|
|