| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. |
| Immunogen | CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT |
| Other Names | NACHRA4|BFNC|EBN|EBN1|NACHR|NACRA4|NARAC|Acra-4|Acra4|ENFL1 |
| Gene, Accession # | Gene ID: 1137,11438,25590 |
| Catalog # | ABIN633758 |
| Price | |
| Order / More Info | Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|