| Edit |   |
| Antigenic Specificity | DEFB132 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 28%, rat 28%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human DEFB132 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS |
| Other Names | defensin, beta 132, DEFB32, RP5-1103G7.6 |
| Gene, Accession # | Gene ID: 400830, UniProt: Q7Z7B7, ENSG00000186458 |
| Catalog # | HPA046399 |
| Price | |
| Order / More Info | DEFB132 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |