| Edit |   |
|---|
| Antigenic Specificity | WAS/WASL Interacting Protein Family, Member 2 (WIPF2) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery. |
|---|
| Immunogen | WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP |
|---|
| Other Names | wich|wire|MGC86383|wip/cr16|WICH|WIRE|1110014J05Rik|5730509C05Rik|AA407487|Gm1176|Wich|Wire|RGD1561080 |
|---|
| Gene, Accession # | Gene ID: 147179 |
|---|
| Catalog # | ABIN633078 |
|---|
| Price | |
|---|
| Order / More Info | WAS/WASL Interacting Protein Family, Member 2 (WIPF2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|