If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for P Glycoprotein detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.
Immunogen
A synthetic peptide corresponding to a sequence of human P Glycoprotein (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY).
Other Names
Multidrug resistance protein 1; ATP-binding cassette sub-family B member 1; P-glycoprotein 1; CD243; ABCB1; MDR1; PGY1