| Edit |   |
| Antigenic Specificity | Abhydrolase Domain Containing 16A (ABHD16A) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity. |
| Immunogen | BAT5 antibody was raised using the N terminal of BAT5 corresponding to a region with amino acids VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK |
| Other Names | BAT5|D6S82E|NG26|PP199|AI326074|Bat-5|Bat5|D17H6S82E|bat5|bat5l|wu:fb55e01|bat5-b|ng26|pp199 |
| Gene, Accession # | Gene ID: 7920,193742 |
| Catalog # | ABIN635476 |
| Price | |
| Order / More Info | Abhydrolase Domain Containing 16A (ABHD16A) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |