| Edit |   |
| Antigenic Specificity | AAMDC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 95%, rat 90%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human AAMDC polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC |
| Other Names | adipogenesis associated, Mth938 domain containing, C11orf67, CK067, FLJ21035, PTD015 |
| Gene, Accession # | Gene ID: 28971, UniProt: Q9H7C9, ENSG00000087884 |
| Catalog # | HPA037919 |
| Price | |
| Order / More Info | AAMDC Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |