| Edit |   |
| Antigenic Specificity | ABCD3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 96%, rat 96%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human ABCD3 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS |
| Other Names | ATP-binding cassette, sub-family D (ALD), member 3, PMP70, PXMP1, ZWS2 |
| Gene, Accession # | Gene ID: 5825, UniProt: P28288, ENSG00000117528 |
| Catalog # | HPA032027 |
| Price | |
| Order / More Info | ABCD3 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |