If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for ATP-binding cassette sub-family B member 10, mitochondrial(ABCB10) detection. Tested with WB in Human;Rat. No cross reactivity with other proteins. ABCB10, also known as M-ABC2, is expressed as a 60-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.
Other Names
ATP-binding cassette sub-family B member 10, mitochondrial;ATP-binding cassette transporter 10;ABC transporter 10 protein;Mitochondrial ATP-binding cassette 2;M-ABC2;ABCB10;