| Edit |   |
|---|
| Antigenic Specificity | Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. |
|---|
| Immunogen | SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ |
|---|
| Other Names | SIGLEC7|AIRM1|CD328|CDw328|D-siglec|QA79|SIGLEC-7|SIGLEC19P|SIGLECP2|p75|p75/AIRM1 |
|---|
| Gene, Accession # | Gene ID: 27036 |
|---|
| Catalog # | ABIN634724 |
|---|
| Price | |
|---|
| Order / More Info | Sialic Acid Binding Ig-Like Lectin 7 (SIGLEC7) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|