If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
Rabbit IgG polyclonal Picoband? antibody for Very long-chain specific acyl-CoA dehydrogenase, mitochondrial(ACADVL) detection. Tested with WB in Human;Rat. No cross reactivity with other proteins. Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ACADVL (538-576aa RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Other Names
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial;VLCAD;1.3.8.9;ACADVL;VLCAD;