| Edit |   |
| Antigenic Specificity | DNA-Damage Inducible 1 Homolog 1 (S. Cerevisiae) (DDI1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The function of DDI1 protein is not widely studied, and is yet to be elucidated fully. |
| Immunogen | DDI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE |
| Other Names | 1700011N24Rik|RGD1559430 |
| Gene, Accession # | Gene ID: 414301 |
| Catalog # | ABIN632869 |
| Price | |
| Order / More Info | DNA-Damage Inducible 1 Homolog 1 (S. Cerevisiae) (DDI1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |