If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
n/a
Immunogen
Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (also known as Receptor expression-enhancing protein 1, C2orf23, D6Ertd253e and rCG_56072, accession number Q8BGH4) Rat: 97% identity (89/91 amino acids identical) Human: 95% identity (87/91 amino acids identical) Some identity with REEP2
Other Names
Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)