| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | AAMDC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AAMDC Antibody from Novus Biologicals is a rabbit polyclonal antibody to AAMDC. This antibody reacts with human. The AAMDC Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C11orf67 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK |
| Other Names | adipogenesis associated, Mth938 domain containing, C11orf67, chromosome 11 open reading frame 67, CK067, FLJ21035, hypothetical protein LOC28971, MGC3367, PTD015 |
| Gene, Accession # | AAMDC, Gene ID: 28971, Accession: Q9H7C9, SwissProt: Q9H7C9 |
| Catalog # | NBP2-34040 |
| Price | |
| Order / More Info | AAMDC Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|