| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | AAR2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AAR2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AAR2. This antibody reacts with human. The AAR2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human C20orf4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLRE |
| Other Names | AAR2 splicing factor homolog (S. cerevisiae), bA234K24.2, C20orf4, CGI-23, chromosome 20 open reading frame 4, DKFZp564N1363, hypothetical protein LOC25980 |
| Gene, Accession # | AAR2, Gene ID: 25980, Accession: Q9Y312, SwissProt: Q9Y312 |
| Catalog # | NBP2-30422 |
| Price | |
| Order / More Info | AAR2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|