| Edit |   |
|---|
| Antigenic Specificity | Nova2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nova2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nova2. This antibody reacts with human. The Nova2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NOVA2 (neuro-oncological ventral antigen 2) The peptide sequence was selected from the middle region of NOVA2. Peptide sequence EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP. |
|---|
| Other Names | neuro-oncological ventral antigen 2ANOVANOVA3Astrocytic NOVA1-like RNA-binding protein, neuro-oncological ventral antigen 3, RNA-binding protein Nova-2 |
|---|
| Gene, Accession # | NOVA2, Gene ID: 4858, Accession: Q9UNW9, SwissProt: Q9UNW9 |
|---|
| Catalog # | NBP1-57296 |
|---|
| Price | |
|---|
| Order / More Info | Nova2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|