Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The NOV/CCN3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NOV/CCN3. This antibody reacts with human. The NOV/CCN3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NOV/CCN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGC
Other Names
CCN family member 3, CCN3IGF-binding protein 9, IBP-9, IGFBP-9, IGFBP9novH, Insulin-like growth factor-binding protein 9, nephroblastoma overexpressed gene, Nephroblastoma-overexpressed gene protein homolog, NOVH, protein NOV homolog