| Edit |   |
| Antigenic Specificity | serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 4 (SERPINB4) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SERPINB4 may act as a protease inhibitor to modulate the host immune response against tumor cells. |
| Immunogen | SERPINB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ |
| Other Names | 1110001H02Rik|1110013A16Rik|Scca2|Serpinb4|Sqn5|LEUPIN|PI11|SCCA-2|SCCA1|SCCA2 |
| Gene, Accession # | Gene ID: 6318 |
| Catalog # | ABIN633159 |
| Price | |
| Order / More Info | serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 4 (SERPINB4) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |