| Edit |   |
| Antigenic Specificity | RANBP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 96%, rat 96%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human RANBP1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PELLAIRFLNAENAQKFKTKFEECRKEIEEREKKGSGKNDHAEKVAEKLEALSV |
| Other Names | RAN binding protein 1, HTF9A |
| Gene, Accession # | Gene ID: 5902, UniProt: P43487, ENSG00000099901 |
| Catalog # | HPA065868 |
| Price | |
| Order / More Info | RANBP1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |