| Edit |   |
|---|
| Antigenic Specificity | TM4SF4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | TM4SF4 antibody. Specificity: TM4SF4 antibody was raised against the N terminal of TM4SF4 |
|---|
| Immunogen | TM4SF4 antibody was raised using the N terminal of TM4SF4 corresponding to a region with amino acids CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG |
|---|
| Other Names | TM4SF4; TM4SF4; TM4SF4; TMSF 4; Transmembrane 4 L Six Family Member 4; TMSF-4; ILTMP; FLJ31015; il-TMP, |
|---|
| Gene, Accession # | TM4SF4 |
|---|
| Catalog # | MBS5302788 |
|---|
| Price | |
|---|
| Order / More Info | TM4SF4 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|