If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
TM9SF4 antibody. Specificity: TM9SF4 antibody was raised against the N terminal of TM9SF4
Immunogen
TM9SF4 antibody was raised using the N terminal of TM9SF4 corresponding to a region with amino acids HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR
Other Names
transmembrane 9 superfamily member 4; Transmembrane 9 superfamily member 4; transmembrane 9 superfamily member 4; transmembrane 9 superfamily protein member 4, TM9SF4; TM9SF4; dJ836N17.2; KIAA0255