| Edit |   |
| Antigenic Specificity | Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes. |
| Immunogen | CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN |
| Other Names | CACNG6|cacng6|MGC122711|2310033H20Rik|AW050150 |
| Gene, Accession # | Gene ID: 59285 |
| Catalog # | ABIN630072 |
| Price | |
| Order / More Info | Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |