| Edit |   |
| Antigenic Specificity | Crystallin, mu (CRYM) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. |
| Immunogen | Crystallin Mu antibody was raised using the N terminal of CRYM corresponding to a region with amino acids ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRT |
| Other Names | CRYM|zgc:158843|DFNA40|THBP |
| Gene, Accession # | Gene ID: 1428 |
| Catalog # | ABIN632295 |
| Price | |
| Order / More Info | Crystallin, mu (CRYM) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |