| Edit |   |
| Antigenic Specificity | Fibronectin Type III Domain Containing 3B (FNDC3B) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | FNDC3B may be a positive regulator of adipogenesis. |
| Immunogen | FNDC3 B antibody was raised using the N terminal of FNDC3 corresponding to a region with amino acids RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP |
| Other Names | FNDC3B|DKFZp469D136|FAD104|PRO4979|YVTM2421|1600019O04Rik|AW550168|Fad104|mKIAA4164|RGD1311673 |
| Gene, Accession # | Gene ID: 64778 |
| Catalog # | ABIN630408 |
| Price | |
| Order / More Info | Fibronectin Type III Domain Containing 3B (FNDC3B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |