| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ABAT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ABAT Antibody from Novus Biologicals is a rabbit polyclonal antibody to ABAT. This antibody reacts with human. The ABAT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ABAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LSVAPKGMSQLITMACGSCSNENALKTIFMWYRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKI |
| Other Names | (S)-3-amino-2-methylpropionate transaminase, 4-aminobutyrate aminotransferase, 4-aminobutyrate aminotransferase, mitochondrial, 4-aminobutyrate transaminase, EC 2.6.1.19, EC 2.6.1.22, FLJ17813, FLJ30272, G, GABA aminotransferase, GABA transaminase, GABA transferase, GABA-AT, GABA-T, GABATNPD009, Gamma-amino-N-butyrate transaminase, hCG1984265, L-AIBAT |
| Gene, Accession # | ABAT, Gene ID: 18, Accession: P80404, SwissProt: P80404 |
| Catalog # | NBP1-83401 |
| Price | |
| Order / More Info | ABAT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|