| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ZW10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZW10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZW10. This antibody reacts with human. The ZW10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ZW10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KGEVCNMISKKYSEFLPSMQSAQGLITQVDKLSEDIDLLKSRIESEVRRDLHVSTGEFTDLKQQLERDSVVLSLLKQLQEFSTAIEEYNCALTEKKYVTG |
| Other Names | E3 ubiquitin-protein ligase ZSWIM2, EC 6.3.2.-, MEKK1-related protein X, MEX, MGC33890, Zinc finger SWIM domain-containing protein 2, zinc finger, SWIM domain containing 2, zinc finger, SWIM-type containing 2, ZZZ2ZZ-type zinc finger-containing protein 2 |
| Gene, Accession # | ZW10, Gene ID: 9183, Accession: O43264, SwissProt: O43264 |
| Catalog # | NBP2-38751 |
| Price | |
| Order / More Info | ZW10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|