| Edit |   |
|---|
| Antigenic Specificity | CYFIP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYFIP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYFIP2. This antibody reacts with human. The CYFIP2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CYFIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STQACQWSPRALFHPTGGTQGRRGCRSLLY |
|---|
| Other Names | cytoplasmic FMR1 interacting protein 2, cytoplasmic FMR1-interacting protein 2, KIAA1168, p53 inducible protein, PIR121p53-inducible protein 121 |
|---|
| Gene, Accession # | CYFIP2, Gene ID: 26999 |
|---|
| Catalog # | NBP2-57502 |
|---|
| Price | |
|---|
| Order / More Info | CYFIP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|