| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | CYP11A1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.025 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CYP11A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYP11A1. This antibody reacts with human. The CYP11A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to CYP11A1(cytochrome P450, family 11, subfamily A, polypeptide 1) The peptide sequence was selected from the N terminal of CYP11A1. Peptide sequence QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL. |
| Other Names | Cholesterol desmolase, cholesterol monooxygenase (side-chain-cleaving), cholesterol side-chain cleavage enzyme, mitochondrial, CYPXIA1, Cytochrome P450 11A1, Cytochrome P450(scc), cytochrome P450, family 11, subfamily A, polypeptide 1, cytochrome P450C11A1, EC 1.14.15, EC 1.14.15.6, steroid 20-22-lyase, subfamily XIA (cholesterol side chain cleavage) |
| Gene, Accession # | CYP11A1, Gene ID: 1583, Accession: P05108, SwissProt: P05108 |
| Catalog # | NBP1-54758SS |
| Price | |
| Order / More Info | CYP11A1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|