Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PPP2R3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R3A. This antibody reacts with human. The PPP2R3A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Immunogen
Synthetic peptides corresponding to PPP2R3A(protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha) The peptide sequence was selected from the N terminal of PPP2R3A. Peptide sequence SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDN
Other Names
PP2A subunit B isoform R3 isoform, PP2A subunit B isoforms B72/B130, PP2A subunit B isoforms B'-PR72/PR130, protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha, serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha, subunit B, R3 isoform