| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | PPP2R3A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPP2R3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R3A. This antibody reacts with human. The PPP2R3A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to PPP2R3A(protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha) The peptide sequence was selected from the N terminal of PPP2R3A. Peptide sequence SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDN |
| Other Names | PP2A subunit B isoform R3 isoform, PP2A subunit B isoforms B72/B130, PP2A subunit B isoforms B'-PR72/PR130, protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha, serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha, subunit B, R3 isoform |
| Gene, Accession # | PPP2R3A, Gene ID: 5523, Accession: Q06190, SwissProt: Q06190 |
| Catalog # | NBP1-54581-20ul |
| Price | |
| Order / More Info | PPP2R3A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|