If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PPP2R5A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R5A. This antibody reacts with human. The PPP2R5A Antibody has been validated for the following applications: Western Blot.
Immunogen
Synthetic peptides corresponding to PPP2R5A(protein phosphatase 2, regulatory subunit B', alpha isoform) The peptide sequence was selected from the N terminal of PPP2R5A. Peptide sequence YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW.
Other Names
B56A, MGC131915, PP2A B subunit isoform B56-alpha, PP2A B subunit isoform B'-alpha, PP2A B subunit isoform PR61-alpha, PP2A B subunit isoform R5-alpha, PP2A, B subunit, B' alpha isoform, PP2A, B subunit, B56 alpha isoform, PP2A, B subunit, PR61 alpha isoform, PP2A, B subunit, R5 alpha isoform, PR61A, PR61alpha, protein phosphatase 2, regulatory subunit B (B56), alpha isoform, protein phosphatase 2, regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alphaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform