| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | PPP2R2B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPP2R2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R2B. This antibody reacts with human. The PPP2R2B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPP2R2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN |
| Other Names | B55BETA, FLJ95686, MGC24888, PP2A subunit B isoform B55-beta, PP2A subunit B isoform beta, PP2A subunit B isoform PR55-beta, PP2A subunit B isoform R2-beta, PP2A, subunit B, B-beta isoform, PP2AB55BETA, PP2ABBETA, PP2APR55B, PP2APR55BETA, PR2AB55BETA, PR2ABBETA, PR2APR55BETA, PR52B, PR55BETA, PR55-BETA, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform, protein phosphatase 2, regulatory subunit B, beta, SCA12, serine/threonine protein phosphatase 2A, 55 kDa regulatory subunit B, betaisoform, serine/threonine protein phosphatase 2A, neuronal isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B betaisoform, spinocerebellar ataxia 12 |
| Gene, Accession # | PPP2R2B, Gene ID: 5521 |
| Catalog # | NBP1-92283 |
| Price | |
| Order / More Info | PPP2R2B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|