Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PPP2R2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R2B. This antibody reacts with human. The PPP2R2B Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPP2R2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSMEEDIDTRKINN
Other Names
B55BETA, FLJ95686, MGC24888, PP2A subunit B isoform B55-beta, PP2A subunit B isoform beta, PP2A subunit B isoform PR55-beta, PP2A subunit B isoform R2-beta, PP2A, subunit B, B-beta isoform, PP2AB55BETA, PP2ABBETA, PP2APR55B, PP2APR55BETA, PR2AB55BETA, PR2ABBETA, PR2APR55BETA, PR52B, PR55BETA, PR55-BETA, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform, protein phosphatase 2, regulatory subunit B, beta, SCA12, serine/threonine protein phosphatase 2A, 55 kDa regulatory subunit B, betaisoform, serine/threonine protein phosphatase 2A, neuronal isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B betaisoform, spinocerebellar ataxia 12