Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The PPP2R5B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R5B. This antibody reacts with human, mouse, rat. The PPP2R5B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PPP2R5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
Other Names
B56B, FLJ35411, PP2A B subunit isoform B56-beta, PP2A B subunit isoform B'-beta, PP2A B subunit isoform PR61-beta, PP2A B subunit isoform R5-beta, PR61B, protein phosphatase 2, regulatory subunit B (B56), beta isoform, protein phosphatase 2, regulatory subunit B', beta, protein phosphatase 2, regulatory subunit B', beta isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, betaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform