| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | PPP2R5B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PPP2R5B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R5B. This antibody reacts with human, mouse, rat. The PPP2R5B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PPP2R5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP |
| Other Names | B56B, FLJ35411, PP2A B subunit isoform B56-beta, PP2A B subunit isoform B'-beta, PP2A B subunit isoform PR61-beta, PP2A B subunit isoform R5-beta, PR61B, protein phosphatase 2, regulatory subunit B (B56), beta isoform, protein phosphatase 2, regulatory subunit B', beta, protein phosphatase 2, regulatory subunit B', beta isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, betaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform |
| Gene, Accession # | PPP2R5B, Gene ID: 5526 |
| Catalog # | NBP1-88958 |
| Price | |
| Order / More Info | PPP2R5B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|