Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The Zyxin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Zyxin. This antibody reacts with human. The Zyxin Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Zyxin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: PKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAF
Other Names
CTCL tumor antigen se14-3, CTCL-associated antigen se14-3, cutaneous T-cell lymphoma associated antigen se14-3, Cutaneous T-cell lymphoma-associated antigen se14-3, KIAA1125, MGC31836, predicted protein of HQ2893, PRKCBP1, PRO2893, protein kinase C-binding protein 1, Rack7, RACK7protein kinase C binding protein 1, zinc finger MYND domain containing protein 8, Zinc finger MYND domain-containing protein 8, zinc finger, MYND-type containing 8