| Edit |   |
| Antigenic Specificity | Keratin 19 (KRT19) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. |
| Immunogen | Cytokeratin 19 antibody was raised using the N terminal of KRT19 corresponding to a region with amino acids LEVKIRDWYQKQGPGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDN |
| Other Names | k19|ck19|k1cs|krt9|krt15|MGC76282|MGC83069|KRT19|CK19|K19|K1CS|GK-19|Ka19|Krt1-19|AI663979|EndoC|Krt-1.19 |
| Gene, Accession # | Gene ID: 3880 |
| Catalog # | ABIN631608 |
| Price | |
| Order / More Info | Keratin 19 (KRT19) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |