BAFF Receptor, Recombinant, Human (BAFFR, TNFRSF13C)
Description
Purity ≥95% by SDS-PAGE gel and HPLC analyses. BAFF Receptor (BAFFR), a member of the TNFR superfamily, is highly expressed in spleen, lymph node, and resting B cells and to some extent in activated B cells, resting CD4+ cells and peripheral blood leukocytes.BAFFR is a type III transmembrane protein that binds with high specificity to BAFF (TNFSF13B).BAFFR/BAFF signaling plays a critical role in B cell survival and maturation.Recombinant human BAFFR is a 76 amino acid polypeptide (7.7kD) corresponding to the extracellular portion of the full BAFFR protein. Biological Activity: Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 2.0-4.0ug/ml in the presence of 1ug/ml of human soluble BAFF. AA Sequence: MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG Crossreactivity: Mouse Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/u