| Edit |   |
|---|
| Antigenic Specificity | CCL26 (full length) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-Human CCL26 (full length) polyclonal antibody for WB. |
|---|
| Immunogen | Full length protein corresponding to Human Eotaxin 3 aa 1-94.Sequence: MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSY EFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL Database link: NP_006063.1 |
|---|
| Other Names | CCL26; chemokine (C-C motif) ligand 26; IMAC; TSC-1; MIP-4a; SCYA26; MIP-4alpha; C-C motif chemokine 26; eotaxin-3; MIP-4-alpha; chemokine N1; CC chemokine IMAC; thymic stroma chemokine-1; small inducible cytokine A26; small-inducible cytokine A26; macrophage inflammatory protein 4-alpha; small inducible cytokine subfamily A (Cys-Cys), member 26; |
|---|
| Gene, Accession # | CCL26, Gene ID: 10344, UniProt: Q9Y258 |
|---|
| Catalog # | DPABH-09958 |
|---|
| Price | |
|---|
| Order / More Info | CCL26 (full length) Antibody from CREATIVE DIAGNOSTICS |
|---|
| Product Specific References | n/a |
|---|