| Edit |   |
|---|
| Antigenic Specificity | SCAMP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCAMP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SCAMP3. This antibody reacts with human. The SCAMP3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SCAMP3 (secretory carrier membrane protein 3) The peptide sequence was selected from the N terminal of SCAMP3. Peptide sequence FQPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT. |
|---|
| Other Names | propin 1, PROPIN1, secretory carrier membrane protein 3C1orf3, secretory carrier-associated membrane protein 3 |
|---|
| Gene, Accession # | SCAMP3, Gene ID: 10067, Accession: O14828-2, SwissProt: O14828-2 |
|---|
| Catalog # | NBP1-69192 |
|---|
| Price | |
|---|
| Order / More Info | SCAMP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|