Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Reviews / Ratings
If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY.
Description
The N4BP2L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to N4BP2L2. This antibody reacts with human. The N4BP2L2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human N4BP2L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVLQEAR
Other Names
CG005FLJ41089, CG016, FLJ36195, NEDD4 binding protein 2-like 2, NEDD4-binding protein 2-like 2, PFAAP5FLJ43077, Phosphonoformate immuno-associated protein 5,92M18.3,92M18.3 (novel protein), protein from BCRA2 region