| Edit |   |
|---|
| Antigenic Specificity | Pannexin 1 (PANX1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mammalian |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties. |
|---|
| Immunogen | Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN |
|---|
| Other Names | panx1|zgc:55631|PANX1|px1|mrs1|pannexin1|Pannexin-1|MRS1|PX1|UNQ2529|AI847747 |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | ABIN635152 |
|---|
| Price | |
|---|
| Order / More Info | Pannexin 1 (PANX1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|