| Edit |   |
| Antigenic Specificity | Pannexin 3 (PANX3) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mammalian |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 μg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions. |
| Immunogen | Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL |
| Other Names | PX3|3230401P04|4833413G11Rik |
| Gene, Accession # | n/a |
| Catalog # | ABIN635645 |
| Price | |
| Order / More Info | Pannexin 3 (PANX3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |