| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | TIM 1/HAVCR1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal antibody for Hepatitis A virus cellular receptor 1(HAVCR1) detection. Tested with WB in Human. No cross reactivity with other proteins. KIM1 (KIDNEY INJURY MOLECULE 1), also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the KIM1 gene. The KIM1 gene is mapped to 5q33.3. Biochemical, mutational, and cell adhesion analyses confirm that Tim1 is capable of homophilic Tim-Tim interactions. The features identified in murine KIM1 are conserved in human KIM1. The KIM1 protein is indeed a receptor for the virus through the infection of canine osteogenic sarcoma cells expressing HAVCR1 with HAV. Using a monoclonal antibody to mouse Tim1, Tim1 is expressed after activation of naive T cells and on T cells differentiated in Th2-polarizing conditions. Ectopic expression of KIM1 during mouse T-cell differentiation leads to production of the Th2-type cytokine Il4, but not the Th1-type cytokine Ifng. KIM1-expressing epithelial cells internalized apoptotic bodies, and Kim1 is directly responsible for phagocytosis in cultured primary rat tubule epithelial cells and in porcine and canine epithelial cell lines. |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD). |
| Other Names | Hepatitis A virus cellular receptor 1;HAVcr-1;Kidney injury molecule 1;KIM-1;T-cell immunoglobulin and mucin domain-containing protein 1;TIMD-1;T-cell immunoglobulin mucin receptor 1;TIM;TIM-1;T-cell membrane protein 1;HAVCR1;KIM1, TIM1, TIMD1; |
| Gene, Accession # | HAVCR1, UniProt: Q96D42 |
| Catalog # | RP1093 |
| Price | |
| Order / More Info | TIM 1/HAVCR1 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|