| Edit |   |
|---|
| Antigenic Specificity | TIFAB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIFAB Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIFAB. This antibody reacts with human. The TIFAB Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TIFAB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ |
|---|
| Other Names | TIFA-Like Protein, TIFA-Related Protein TIFAB, TRAF-Interacting Protein With FHA Domain-Containing Protein B, TRAF-Interacting Protein With Forkhead-Associated Domain, Family Member B |
|---|
| Gene, Accession # | TIFAB, Gene ID: 497189, Accession: Q6ZNK6, SwissProt: Q6ZNK6 |
|---|
| Catalog # | NBP2-33562 |
|---|
| Price | |
|---|
| Order / More Info | TIFAB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|