| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | PD-L2/B7-DC/PDCD1LG2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PD-L2/B7-DC/PDCD1LG2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PD-L2/B7-DC/PDCD1LG2. This antibody reacts with human. The PD-L2/B7-DC/PDCD1LG2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPT |
| Other Names | B7-DC, bA574F11.2, Btdc, Butyrophilin B7-DC, CD273 antigen, CD273PD-1 ligand 2, MGC142240, PD-1-ligand 2, PDCD1L2MGC142238, PDL2B7DC, PD-L2PDCD1 ligand 2, programmed cell death 1 ligand 2, Programmed death ligand 2 |
| Gene, Accession # | PDCD1LG2, Gene ID: 80380 |
| Catalog # | NBP1-88964-25ul |
| Price | |
| Order / More Info | PD-L2/B7-DC/PDCD1LG2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24748806, 29399387 |
| 產(chǎn)品資料 |
|
|