| Edit |   |
| Antigenic Specificity | FAM177B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 28%, rat 48%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human FAM177B polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ |
| Other Names | family with sequence similarity 177, member B, FLJ43505, RP11-452F19.2 |
| Gene, Accession # | Gene ID: 400823, UniProt: A6PVY3, ENSG00000197520 |
| Catalog # | HPA063059 |
| Price | |
| Order / More Info | FAM177B Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |