| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | GAD65/GAD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein. |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid. |
| Other Names | Glutamate decarboxylase 2;4.1.1.15;65 kDa glutamic acid decarboxylase;GAD-65;Glutamate decarboxylase 65 kDa isoform;GAD2;GAD65; |
| Gene, Accession # | GAD2, UniProt: Q05329 |
| Catalog # | A03142 |
| Price | |
| Order / More Info | GAD65/GAD2 Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|