| 產(chǎn)品詳情 |
| Edit |   |
| Antigenic Specificity | ATP7b |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband? antibody for Copper-transporting ATPase 2(ATP7B) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. ATPase, Cu++ transporting, beta polypeptide (Wilson disease) protein, also called ATP7B, is an ATPase that transports copper. This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least two putative copper-binding sites. ATP7B is mapped to 13q14.3. This protein functions as a monomer, exporting copper out of the cells. When copper levels are in excess, ATP7B redistributes to a vesicular compartment near the biliary canalicular membranes for elimination of excess copper into bile, and it is transported along liver cell microtubules via interaction with the p62 dynactin subunit. |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human ATP7b (616-652aa RDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids. |
| Other Names | Copper-transporting ATPase 2;3.6.3.54;Copper pump 2;Wilson disease-associated protein;WND/140 kDa;ATP7B;PWD, WC1, WND; |
| Gene, Accession # | ATP7B, UniProt: P35670 |
| Catalog # | A00686 |
| Price | |
| Order / More Info | ATP7b Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 產(chǎn)品資料 |
|
|