| Edit |   |
| Antigenic Specificity | KDM4E |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 31%, rat 35%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human KDM4E polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLLMGTRSRAQGHRPQLPLANDLMTNLS |
| Other Names | lysine (K)-specific demethylase 4E, JMJD2E, KDM4DL |
| Gene, Accession # | Gene ID: 390245, UniProt: B2RXH2, ENSG00000235268 |
| Catalog # | HPA054225 |
| Price | |
| Order / More Info | KDM4E Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |