| Edit |   |
|---|
| Antigenic Specificity | RanBP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-RanBP2 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE), different from the related mouse sequence by nine amino acids.Subcellular Localization: Nucleus. Nucleus membrane. Nucleus, nuclear pore complex. Detected in dif |
|---|
| Other Names | E3 SUMO-protein ligase RanBP2; E3 SUMO-protein ligase RanBP2; E3 SUMO-protein ligase RanBP2; RAN binding protein 2; 358 kDa nucleoporin; Nuclear pore complex protein Nup358; Nucleoporin Nup358; Ran-binding protein 2; RanBP2; p270, RANBP2; RANBP2; ANE1; TRP1; TRP2; ADANE; IIAE3; NUP358; NUP358; RanBP2 |
|---|
| Gene, Accession # | RanBP2, Gene ID: 5903, NCBI: NP_006258.3, UniProt: P49792 |
|---|
| Catalog # | MBS1750530 |
|---|
| Price | |
|---|
| Order / More Info | RanBP2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|