| Edit |   |
|---|
| Antigenic Specificity | AMH |
|---|
| Clone | 5/6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | baboon, mouse, sheep, squirrel monkey; nb antibody activity and working conditions may vary between species |
|---|
| Isotype | IgG1 |
|---|
| Format | supernatant |
|---|
| Size | 1 mL |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistology Paraffin, Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MOUSE ANTI HUMAN AMH |
|---|
| Immunogen | Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)Target Species: HumanHistology Positive Control Tissue: Ovary |
|---|
| Other Names | muellerian-inhibiting factor; Muellerian-inhibiting factor; muellerian-inhibiting factor; Mullerian inhibiting factor; Mullerian inhibiting substance; Muellerian hormone; muellerian-inhibiting substance; Mullerian hormone; Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS, AMH; AMH; MIF; MIS; MIF; AMH; MIS |
|---|
| Gene, Accession # | AMH, Gene ID: 268, NCBI: NP_000470.2, UniProt: P03971 |
|---|
| Catalog # | MBS215704 |
|---|
| Price | |
|---|
| Order / More Info | AMH Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|