| Edit |   |
| Antigenic Specificity | KCNJ11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 89%, rat 91%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human KCNJ11 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS |
| Other Names | potassium inwardly-rectifying channel, subfamily J, member 11, BIR, Kir6.2 |
| Gene, Accession # | Gene ID: 3767, UniProt: Q14654, ENSG00000187486 |
| Catalog # | HPA048891 |
| Price | |
| Order / More Info | KCNJ11 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |